Tesamorelin 10mg
Price range: $84.99 through $139.99
Buy Peptide Injections | Tesamorelin | 10mg
Specifications:
- Unit Size: 10mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC Verified)
- Molecular Formula: C221H366N72O67S1
- Molecular Weight: ~5135.9 Da
Buy Peptide Injections | Tesamorelin 10mg
Buy peptide injections, Tesamorelin 10mg is a stabilized GHRH analog for in vitro studies related to fat metabolism, GH release, and endocrine
| quantity |
10mg ,20mg |
|---|
1 review for Tesamorelin 10mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
BPC-157 5mg
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
- Molecular Weight: 1419.5 g/mol
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
CJC 1295 no dac + Ipamorelin 5mg/5mg
GLP-3/Retatrutide
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol
Human Growth Hormone(HGH)
HGH-Frag (Fragment 176–191)
This C-terminal segment of human growth hormone is selected in model systems to explore assay endpoints linked to receptor-adjacent pathways and peptide pharmacology. All work takes place in laboratory settings only. For laboratory research only. Not for human use.HGH-Frag Key features
- C-terminal hGH fragment (176–191) for in-vitro signalling and SAR investigations.
- Supplied as a lyophilised solid for stability and straightforward storage.
- Each batch released only after stringent quality checks.
IGF1-LR3 1mg
Buy Peptide Injections | IGF-1 LR3 | 1mg
Specifications:
- Quantity: 1mg
- Form: Lyophilized Powder
- Sequence: MFPAMPLSSL…GGY (83 amino acids, with Arg³ substitution)
- Molecular Weight: ~9111 Da
- Purity: ≥99% (HPLC verified)
TB-500 5mg
Buy Peptide Injections | TB-500 | 5mg
Specifications:
- Unit Size: 5mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC)
- Molecular Weight: ~4963 Da
Christina Rose –
USA vouch for Leo, Ordered Sunday, at my door Tuesday. COAs legit. No customs BS. A+”