CJC 1295 no dac + Ipamorelin 5mg/5mg
Original price was: $89.00.$80.50Current price is: $80.50.
Buy peptide online, CJC-1295 (No DAC) + Ipamorelin 5mg/5mg peptide blend for in vitro studies.
Buy Peptide Online | CJC-1295 (No DAC) + Ipamorelin | 5mg/5mg Blend
Buy peptide online, Quantity: 5mg CJC-1295 (No DAC) + 5mg Ipamorelin (Total: 10mg)
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
| quantity |
5mg |
|---|
2 reviews for CJC 1295 no dac + Ipamorelin 5mg/5mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol
Human Growth Hormone(HGH)
HGH-Frag (Fragment 176–191)
This C-terminal segment of human growth hormone is selected in model systems to explore assay endpoints linked to receptor-adjacent pathways and peptide pharmacology. All work takes place in laboratory settings only. For laboratory research only. Not for human use.HGH-Frag Key features
- C-terminal hGH fragment (176–191) for in-vitro signalling and SAR investigations.
- Supplied as a lyophilised solid for stability and straightforward storage.
- Each batch released only after stringent quality checks.
IGF1-LR3 1mg
Buy Peptide Injections | IGF-1 LR3 | 1mg
Specifications:
- Quantity: 1mg
- Form: Lyophilized Powder
- Sequence: MFPAMPLSSL…GGY (83 amino acids, with Arg³ substitution)
- Molecular Weight: ~9111 Da
- Purity: ≥99% (HPLC verified)
Selank 5mg
Buy Peptide Injections | Selank | 5mg | 10mg
Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro
- Molecular Weight: 751.9 g/mol
- Purity: ≥99% (HPLC verified)
Semaglutide
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg 2ml sterile water = 20 x 0.1ml / 100mcg 1mg = 1000mcg
This product is not: - intended to treat, cure or prevent any disease - a sports supplement - approved for human application - an injectable medicine
TB-500 5mg
Buy Peptide Injections | TB-500 | 5mg
Specifications:
- Unit Size: 5mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC)
- Molecular Weight: ~4963 Da
Adam Shaw –
I’m from uk. 1st order took 12 days 2nd order was around 7-8 days
Mayra Herrera –
First oder arrived in 10 days to germany, well packaged and great customer support.