Glow 70mg (GHK-Cu/BPC157/TB500)
Price range: $72.00 through $110.00
Buy Peptide Injections | Glow 70mg (GHK-Cu/BPC157/TB500)
Glow 70mg proprietary peptide blend for advanced in vitro research in skin rejuvenation, collagen support, and tissue regeneration.
Buy Peptide Injections | Glow | 70mg
Buy Peptide Injections, Quantity: 70mg
- Form: Lyophilized Powder
- Purity: ≥99.9% (HPLC verified)
- Blend Type: Proprietary peptide complex (individual components undisclosed for IP protection)
| quantity |
10mg ,50mg ,70mg |
|---|
4 reviews for Glow 70mg (GHK-Cu/BPC157/TB500)
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
AOD-9604
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
CJC 1295 no dac + Ipamorelin 5mg/5mg
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
IGF1-LR3 1mg
Buy Peptide Injections | IGF-1 LR3 | 1mg
Specifications:
- Quantity: 1mg
- Form: Lyophilized Powder
- Sequence: MFPAMPLSSL…GGY (83 amino acids, with Arg³ substitution)
- Molecular Weight: ~9111 Da
- Purity: ≥99% (HPLC verified)
Selank 5mg
Buy Peptide Injections | Selank | 5mg | 10mg
Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro
- Molecular Weight: 751.9 g/mol
- Purity: ≥99% (HPLC verified)
Adipotide
buy adipotide online, Pepmanleo Pharmacy Online supplies this product solely for research use, provided in a freeze-dried (lyophilized) powder form. In accordance with regulatory guidelines, we are unable to offer guidance on dosage or instructions for reconstitution.
The amount listed on the product label reflects the total contents of the vial.
To reconstitute the product, researchers will need the following laboratory materials:
• A suitable reconstitution fluid
• Syringes for withdrawing the solution from the vials
• Alcohol swabs for sterilizing surfaces
Madonna Allore –
Been around a month I got my order and wanted to give an update.First of incredible service and really fast shipping. Secondly now that I have had time to use products I’m really happy with the results and can confidently say it’s the deal.Actually going to order again now,highly recommended.
Pablo j –
just placed my second order! first order went amazing i’ve seen incredible results im basically taking glow stack plus reta and this is my 5th week of reta and im down 20 pounds food noise is nothing gut and joints feel healthy as ever no more inclination problems or pains in the gym or work and my skin is literally glowing best products out there and Leo makes everything so easy thank you this company has been nothing but amazing!!! USA customer btw 🙌🧪
Lilliana Renna –
Ordered for lab research. COA matched the batch I received and everything reconstituted clean with no issues. Vendor answered my questions about storage fast. Will order again
Eleanor Dawson –
First order with them and it went smooth. Website was easy, payment options were clear, and tracking updated quickly. Product looks good for research purposes.