IGF1-LR3 1mg
Original price was: $106.00.$94.99Current price is: $94.99.
Buy Peptide Injections | IGF-1 LR3 | 1mg
Specifications:
- Quantity: 1mg
- Form: Lyophilized Powder
- Sequence: MFPAMPLSSL…GGY (83 amino acids, with Arg³ substitution)
- Molecular Weight: ~9111 Da
- Purity: ≥99% (HPLC verified)
Buy Peptite Injections | IGF1-LR3 1mg
| quantity |
1mg |
|---|
2 reviews for IGF1-LR3 1mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
AOD-9604
BPC-157/TB500 5mg/5mg Blend
Buy Peptide Injections | BPC-157/TB500 | 5mg/5mg Blend
Specifications:
- Quantity: 5mg/5mg
- Form: Lyophilized Powder
- Blend Type: Multi-peptide recovery support formula (inquire for exact composition)
- Purity: ≥99% (HPLC verified)
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol
Selank 5mg
Buy Peptide Injections | Selank | 5mg | 10mg
Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro
- Molecular Weight: 751.9 g/mol
- Purity: ≥99% (HPLC verified)
Sermorelin 10mg
Buy Peptide Injections | Sermorelin | 10mg |
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
- Molecular Weight: ~3357.96 Da
- Purity: ≥99% (HPLC verified)
Adipotide
buy adipotide online, Pepmanleo Pharmacy Online supplies this product solely for research use, provided in a freeze-dried (lyophilized) powder form. In accordance with regulatory guidelines, we are unable to offer guidance on dosage or instructions for reconstitution.
The amount listed on the product label reflects the total contents of the vial.
To reconstitute the product, researchers will need the following laboratory materials:
• A suitable reconstitution fluid
• Syringes for withdrawing the solution from the vials
• Alcohol swabs for sterilizing surfaces
Mark Andy –
Order arrived 15days after ordering. Was stuck in my local customs for 3 or 4 days, everything looks good as usual Leo great as always ❤️
Amy David –
Shipped to Malaysia safe and sound😍.. fastest shipment ever.. took 10 days to arrived.. thank you Pepmanleo