TB-500 5mg
Price range: $39.99 through $75.00
Buy Peptide Injections | TB-500 | 5mg
Specifications:
- Unit Size: 5mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC)
- Molecular Weight: ~4963 Da
Buy Peptide Injections | TB-500 5mg
Buy peptide injections, TB-500 (Thymosin Beta-4) peptide for in vitro studies on tissue regeneration, inflammation, and cellular migration.
| quantity |
10mg ,5mg |
|---|
3 reviews for TB-500 5mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
BPC-157 5mg
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
- Molecular Weight: 1419.5 g/mol
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol
Selank 5mg
Buy Peptide Injections | Selank | 5mg | 10mg
Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro
- Molecular Weight: 751.9 g/mol
- Purity: ≥99% (HPLC verified)
Semaglutide
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg 2ml sterile water = 20 x 0.1ml / 100mcg 1mg = 1000mcg
This product is not: - intended to treat, cure or prevent any disease - a sports supplement - approved for human application - an injectable medicine
Asher Collins –
Got my second order recently and have been very happy with Team Leo. Works very well and the products are consistent
Codin –
Great services,I recommend pepmanleo
George Gruver –
Mr. Leo beats most domestic lists by $15-20/kit. Got TB-500 + BPC stack shipped for $XX. Janoshik verified.