Ipamorelin 10mg
$75.00 – $110.00Price range: $75.00 through $110.00
Buy Peptide Injections | Ipamorelin | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂
- Molecular Weight: 711.9 g/mol
- Purity: ≥99% (HPLC verified)
Buy Peptide Injections | Ipamorelin 10mg
Buy peptide injections, High-purity Ipamorelin lyophilized peptide for in vitro research. Commonly studied for GH release, ghrelin receptor interaction, and cellular regeneration.
| quantity |
10mg ,20mg |
|---|
2 reviews for Ipamorelin 10mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
BPC-157 5mg
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
- Molecular Weight: 1419.5 g/mol
BPC-157/TB500 5mg/5mg Blend
Buy Peptide Injections | BPC-157/TB500 | 5mg/5mg Blend
Specifications:
- Quantity: 5mg/5mg
- Form: Lyophilized Powder
- Blend Type: Multi-peptide recovery support formula (inquire for exact composition)
- Purity: ≥99% (HPLC verified)
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
Glow 70mg (GHK-Cu/BPC157/TB500)
Buy Peptide Injections | Glow 70mg (GHK-Cu/BPC157/TB500)
GLP-3/Retatrutide
NAD+ 500mg
Buy Peptide Injections | NAD+ 500mg
Specifications:
- Quantity: 500mg
- Form: Lyophilized Powder
- Molecular Weight: 663.43 g/mol
- Purity: ≥99% (HPLC validated)
Semaglutide
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg 2ml sterile water = 20 x 0.1ml / 100mcg 1mg = 1000mcg
This product is not: - intended to treat, cure or prevent any disease - a sports supplement - approved for human application - an injectable medicineSemax 5mg
Buy Peptide Injections | Semax | 5mg
Buy Peptide Injections, For In Vitro Research Use Only – Not for Human or Veterinary ApplicationProduct Overview:
Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH 4-10) developed for its neuroprotective and cognitive-enhancing properties. Buy Peptide injections, It is widely studied for its potential to modulate brain-derived neurotrophic factor (BDNF), improve neuroplasticity, and regulate stress response mechanisms.Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
- Molecular Weight: 831.0 g/mol
- Purity: ≥99% (HPLC validated)
- Storage:
- Lyophilized: Store at -20°C or below
- After reconstitution: Store at 2°C–8°C and use within 10–14 days under sterile conditions
Applications:
Semax is commonly used in research investigating:- BDNF expression and neurotrophic regulation
- Cognitive function and memory mechanisms
- Stroke, ischemia, and neuroprotection models
- Stress and anxiety pathway studies

Jonah Sayne –
Order number 4,it keeps getting better 🙏
Dave Rolland –
Just received my second order, same as last time! Great service and fast shipping. Thanks so much🙏🙏