-8%
buy peptide injections
buy peptide injections
Semax 5mg Price range: $29.50 through $49.00
Back to products
TB-500 5mg
TB-500 5mg Price range: $39.99 through $75.00

Sermorelin 10mg

Price range: $37.00 through $60.00

Buy Peptide Injections | Sermorelin | 10mg |

Specifications:
  • Quantity: 10mg
  • Form: Lyophilized Powder
  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
  • Molecular Weight: ~3357.96 Da
  • Purity: ≥99% (HPLC verified)
42 Items sold in last 21 months
Add to compare
Add to wishlist
64 People watching this product now!
SKU: N/A Category:
Description

Buy peptide injections |  Sermorelin 10mg

Buy peptide injections, Sermorelin lyophilized peptide for in vitro research on growth hormone release and pituitary signaling.

Additional information
quantity

10mg

,

5mg
Reviews (0)
0 reviews
0
0
0
0
0

Reviews

Clear filters

There are no reviews yet.

Be the first to review “Sermorelin 10mg”

Your email address will not be published. Required fields are marked *

Shipping & Delivery

Buy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.

ALL YOUR SHIPMENT IN ONE PLACE

Pickup and Deliver Anywhere - Global and Domestic Shipping

From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.

Ship Anything - Boxes, Pallets, and Everything in Between

Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.

PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE

Related products

-8%Hot
Add to compare

AHK-CU

Price range: $42.00 through $55.00
  1. Uhbuy ahk-cu online, AHK-Cu (Copper Tripeptide-1) is a copper peptide used in research to improve scalp health and promote healthier hair. Studies have shown that when applied topically, it stimulates dermal papilla cells, which are crucial for the growth of hair follicles..!
Add to wishlist
Select options This product has multiple variants. The options may be chosen on the product page
Quick view
Hot
buy peptide injections
Add to compare

Cagrilintide 10mg

Price range: $120.00 through $155.00

Buy Peptide Injections | Cagrilintide | 10mg

Specifications:
  • Quantity: 10mg
  • Form: Lyophilized Powder
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
  • Molecular Weight: ~4409 g/mol
  • Purity: ≥99% (HPLC verified)
Add to wishlist
Select options This product has multiple variants. The options may be chosen on the product page
Quick view
-10%
buy GHK-Cu online
Add to compare

GHK-Cu

Price range: $38.00 through $85.00

GHK-Cu | 50mg | 100mg

Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary Use
Product Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.
Specifications:
  • Quantity: 50mg | 100mg
  • Form: Lyophilized Powder
  • Sequence: Gly-His-Lys-Cu
  • Molecular Weight: ~340.8 Da
  • Purity: ≥99% (HPLC verified)
Add to wishlist
Select options This product has multiple variants. The options may be chosen on the product page
Quick view
-15%
buy peptide injections
Add to compare

Glow 70mg (GHK-Cu/BPC157/TB500)

Price range: $72.00 through $110.00

Buy Peptide Injections | Glow 70mg (GHK-Cu/BPC157/TB500)

Glow 70mg proprietary peptide blend for advanced in vitro research in skin rejuvenation, collagen support, and tissue regeneration.
Add to wishlist
Select options This product has multiple variants. The options may be chosen on the product page
Quick view
Add to compare

Human Growth Hormone(HGH)

Price range: $65.00 through $220.00
HGH-Frag (human growth hormone fragment 176–191) is a research peptide used in controlled in-vitro studies of growth-factor–related signalling, energy-metabolism readouts, and peptide structure–activity relationships under non-clinical laboratory conditions.

HGH-Frag (Fragment 176–191)

This C-terminal segment of human growth hormone is selected in model systems to explore assay endpoints linked to receptor-adjacent pathways and peptide pharmacology. All work takes place in laboratory settings only. For laboratory research only. Not for human use.

HGH-Frag Key features

  • C-terminal hGH fragment (176–191) for in-vitro signalling and SAR investigations.
  • Supplied as a lyophilised solid for stability and straightforward storage.
  • Each batch released only after stringent quality checks.
Add to wishlist
Select options This product has multiple variants. The options may be chosen on the product page
Quick view
-13%
Add to compare

MT 2 10mg

Price range: $39.00 through $69.50

‏Buy Peptide Injections | MT 2 | 10mg

Specifications:
  • Quantity: 10mg
  • Form: Lyophilized Powder
  • Sequence: Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂
  • Molecular Weight: 1024.18 g/mol
  • Purity: ≥99% (HPLC verified)
Add to wishlist
Select options This product has multiple variants. The options may be chosen on the product page
Quick view
-13%New
buy peptide injections
Add to compare

Selank 5mg

Price range: $39.00 through $79.99

Buy Peptide Injections | Selank | 5mg | 10mg

Specifications:
  • Quantity: 5mg
  • Form: Lyophilized Powder
  • Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro
  • Molecular Weight: 751.9 g/mol
  • Purity: ≥99% (HPLC verified)
Add to wishlist
Select options This product has multiple variants. The options may be chosen on the product page
Quick view
-42%Hot
Add to compare

Adipotide

Price range: $20.00 through $39.00

buy adipotide online, Pepmanleo Pharmacy Online supplies this product solely for research use, provided in a freeze-dried (lyophilized) powder form. In accordance with regulatory guidelines, we are unable to offer guidance on dosage or instructions for reconstitution.

The amount listed on the product label reflects the total contents of the vial.

To reconstitute the product, researchers will need the following laboratory materials:

• A suitable reconstitution fluid

• Syringes for withdrawing the solution from the vials

• Alcohol swabs for sterilizing surfaces

Add to wishlist
Select options This product has multiple variants. The options may be chosen on the product page
Quick view