BPC-157/TB500 5mg/5mg Blend
$115.00 Original price was: $115.00.$90.00Current price is: $90.00.
Buy Peptide Injections | BPC-157/TB500 | 5mg/5mg Blend
Specifications:
- Quantity: 5mg/5mg
- Form: Lyophilized Powder
- Blend Type: Multi-peptide recovery support formula (inquire for exact composition)
- Purity: ≥99% (HPLC verified)
Buy Peptide Injections | BPC-157/TB500 5mg/5mg Blend
Buy peptide injections, BPC-157/TB500 5mg/5mg Blend lyophilized peptide blend for in vitro research. Commonly studied for tissue repair, recovery enhancement, and cellular regeneration pathways.
| quantity |
5mg |
|---|
2 reviews for BPC-157/TB500 5mg/5mg Blend
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
BPC-157 5mg
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
- Molecular Weight: 1419.5 g/mol
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
MOTS-C 10mg
MT 2 10mg
Buy Peptide Injections | MT 2 | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂
- Molecular Weight: 1024.18 g/mol
- Purity: ≥99% (HPLC verified)
Selank 5mg
Buy Peptide Injections | Selank | 5mg | 10mg
Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro
- Molecular Weight: 751.9 g/mol
- Purity: ≥99% (HPLC verified)
Semaglutide
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg 2ml sterile water = 20 x 0.1ml / 100mcg 1mg = 1000mcg
This product is not: - intended to treat, cure or prevent any disease - a sports supplement - approved for human application - an injectable medicineSermorelin 10mg
Buy Peptide Injections | Sermorelin | 10mg |
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
- Molecular Weight: ~3357.96 Da
- Purity: ≥99% (HPLC verified)
Tesamorelin 10mg
Buy Peptide Injections | Tesamorelin | 10mg
Specifications:
- Unit Size: 10mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC Verified)
- Molecular Formula: C221H366N72O67S1
- Molecular Weight: ~5135.9 Da

Frederick J –
Leo’s prices beat most domestic lists. Got TB-500 + BPC stack shipped. Arrived 2 days. HPLC verified. If you’re in US and waiting 2+ weeks from overseas you’re doing it wrong.”
Markus H –
USA vouch Mr. Leo. 2-day ship, HPLC tested, no customs BS. BPC/TB healed my shoulder. 10/10″