Semaglutide
$31.00 – $160.00Price range: $31.00 through $160.00
Usage Instructions:
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg
2ml sterile water = 20 x 0.1ml / 100mcg
1mg = 1000mcg
This product is not:
– intended to treat, cure or prevent any disease
– a sports supplement
– approved for human application
– an injectable medicine
Introducing Semaglutide 2mg, a cutting-edge solution for individuals seeking effective management of type 2 diabetes. Product comes complete with bacteriostatic water, providing you with a comprehensive and user-friendly experience.
Benefits:
- Effective Diabetes Management: Nordic Labs Semaglutide 2mg is designed to help regulate blood sugar levels, providing a powerful tool in the management of type 2 diabetes.
- Convenient Administration: The inclusion of bacteriostatic water ensures a hassle-free mixing process, enhancing the product’s user-friendliness.
- Long-Lasting Effects: Semaglutide offers sustained blood sugar control, reducing the frequency of injections and providing lasting benefits throughout the day.
- Weight Management: Many users report weight loss as a positive side effect, making Semaglutide a valuable option for those looking to achieve or maintain a healthy weight.
| quantity |
10mg ,15mg ,2mg ,30mg ,50mg ,5mg |
|---|
1 review for Semaglutide
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
AHK-CU
- Uhbuy ahk-cu online, AHK-Cu (Copper Tripeptide-1) is a copper peptide used in research to improve scalp health and promote healthier hair. Studies have shown that when applied topically, it stimulates dermal papilla cells, which are crucial for the growth of hair follicles..!
BPC-157/TB500 5mg/5mg Blend
Buy Peptide Injections | BPC-157/TB500 | 5mg/5mg Blend
Specifications:
- Quantity: 5mg/5mg
- Form: Lyophilized Powder
- Blend Type: Multi-peptide recovery support formula (inquire for exact composition)
- Purity: ≥99% (HPLC verified)
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
GLP-3/Retatrutide
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol

Rachael D Costa –
Ordered 8 kits semaglutide for group. All same batch, all tested 99%+. Split shipping to 3 states, everyone got it in 3 days. No heat damage. Solid for group buys.