Cagrilintide 10mg
$120.00 – $155.00Price range: $120.00 through $155.00
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
Buy Peptide Injections | Cagrilintide 10mg
Buy peptide injections, Cagrilintide lyophilized peptide.
| quantity |
10mg ,20mg |
|---|
1 review for Cagrilintide 10mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
Glow 70mg (GHK-Cu/BPC157/TB500)
Buy Peptide Injections | Glow 70mg (GHK-Cu/BPC157/TB500)
Human Growth Hormone(HGH)
HGH-Frag (Fragment 176–191)
This C-terminal segment of human growth hormone is selected in model systems to explore assay endpoints linked to receptor-adjacent pathways and peptide pharmacology. All work takes place in laboratory settings only. For laboratory research only. Not for human use.HGH-Frag Key features
- C-terminal hGH fragment (176–191) for in-vitro signalling and SAR investigations.
- Supplied as a lyophilised solid for stability and straightforward storage.
- Each batch released only after stringent quality checks.
IGF1-LR3 1mg
Buy Peptide Injections | IGF-1 LR3 | 1mg
Specifications:
- Quantity: 1mg
- Form: Lyophilized Powder
- Sequence: MFPAMPLSSL…GGY (83 amino acids, with Arg³ substitution)
- Molecular Weight: ~9111 Da
- Purity: ≥99% (HPLC verified)
MOTS-C 10mg
MT 2 10mg
Buy Peptide Injections | MT 2 | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂
- Molecular Weight: 1024.18 g/mol
- Purity: ≥99% (HPLC verified)
Semaglutide
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg 2ml sterile water = 20 x 0.1ml / 100mcg 1mg = 1000mcg
This product is not: - intended to treat, cure or prevent any disease - a sports supplement - approved for human application - an injectable medicineSemax 5mg
Buy Peptide Injections | Semax | 5mg
Buy Peptide Injections, For In Vitro Research Use Only – Not for Human or Veterinary ApplicationProduct Overview:
Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH 4-10) developed for its neuroprotective and cognitive-enhancing properties. Buy Peptide injections, It is widely studied for its potential to modulate brain-derived neurotrophic factor (BDNF), improve neuroplasticity, and regulate stress response mechanisms.Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
- Molecular Weight: 831.0 g/mol
- Purity: ≥99% (HPLC validated)
- Storage:
- Lyophilized: Store at -20°C or below
- After reconstitution: Store at 2°C–8°C and use within 10–14 days under sterile conditions
Applications:
Semax is commonly used in research investigating:- BDNF expression and neurotrophic regulation
- Cognitive function and memory mechanisms
- Stroke, ischemia, and neuroprotection models
- Stress and anxiety pathway studies
Tesamorelin 10mg
Buy Peptide Injections | Tesamorelin | 10mg
Specifications:
- Unit Size: 10mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC Verified)
- Molecular Formula: C221H366N72O67S1
- Molecular Weight: ~5135.9 Da

Antony D –
Great service and fast shipping,thanks Leo