AHK-CU
$42.00 – $55.00Price range: $42.00 through $55.00
- Uhbuy ahk-cu online, AHK-Cu (Copper Tripeptide-1) is a copper peptide used in research to improve scalp health and promote healthier hair. Studies have shown that when applied topically, it stimulates dermal papilla cells, which are crucial for the growth of hair follicles..!
Buy ahk-cu online, Potential Benefits of AHK-Cu
AHK-Cu has several potential benefits for improving scalp and follicle health. By stimulating dermal papilla cells, it encourages the growth of hair follicles and supports regrowth of pattern hair loss.
Buy ahk-cu online, this peptide promotes skin repair, helping to rejuvenate damaged scalp areas. In addition, the copper ions of AHK-Cu supports the synthesis of collagen and elastin, key components for maintaining a clean, healthy scalp and improving elasticity.
One of the most important benefits of this peptide is its ability to reduce oxidative stress. By increasing the production of superoxide dismutase (SOD), AHK-Cu may help neutralize harmful free radicals that can damage follicles and lead to thinning. [4]
Buy ahk-cu online, his action not only protects hair follicle activity but may also help prevent the negative effects of DHT, contributing to a reduction in thinning and supporting overall scalp health.
It is also thought to promote better circulation, which supports the formation of new blood vessels in the scalp. This improved circulation helps nourish the follicles, encouraging the production of amino acids and other nutrients essential for follicle growth. By supporting tissue repair, AHK-Cu can also help reduce fine lines on the scalp, improving skin tone and skin elasticity.
Buy ahk-cu-online, How Should AHK-Cu Be Stored?
For best results, AHK-Cu should be stored in a cool, dry place, away from direct sunlight. Proper storage helps maintain the purity and stability of the peptide, ensuring its effectiveness for research into scalp health, follicle regeneration, and regrowth treatments.
| quantity |
10mg ,20mg ,30mg ,40mg ,50mg |
|---|
4 reviews for AHK-CU
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
BPC-157 5mg
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
- Molecular Weight: 1419.5 g/mol
BPC-157/TB500 5mg/5mg Blend
Buy Peptide Injections | BPC-157/TB500 | 5mg/5mg Blend
Specifications:
- Quantity: 5mg/5mg
- Form: Lyophilized Powder
- Blend Type: Multi-peptide recovery support formula (inquire for exact composition)
- Purity: ≥99% (HPLC verified)
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
Glow 70mg (GHK-Cu/BPC157/TB500)
Buy Peptide Injections | Glow 70mg (GHK-Cu/BPC157/TB500)
GLP-3/Retatrutide
Human Growth Hormone(HGH)
HGH-Frag (Fragment 176–191)
This C-terminal segment of human growth hormone is selected in model systems to explore assay endpoints linked to receptor-adjacent pathways and peptide pharmacology. All work takes place in laboratory settings only. For laboratory research only. Not for human use.HGH-Frag Key features
- C-terminal hGH fragment (176–191) for in-vitro signalling and SAR investigations.
- Supplied as a lyophilised solid for stability and straightforward storage.
- Each batch released only after stringent quality checks.
Ipamorelin 10mg
Buy Peptide Injections | Ipamorelin | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂
- Molecular Weight: 711.9 g/mol
- Purity: ≥99% (HPLC verified)
TB-500 5mg
Buy Peptide Injections | TB-500 | 5mg
Specifications:
- Unit Size: 5mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC)
- Molecular Weight: ~4963 Da

Chris Perry –
Got it in 2 weeks. Love the service
Return customer. Highly recommend!
Amy David –
Shipped to Malaysia safe and sound😍.. fastest shipment ever.. took 10 days to arrived.. thank you pepmanleo
Jeremy B –
Thanks for the delivery, arrived just in time
Bean Pellas –
What I check: 1. Vial vacuum seal 2. Label batch # matches COA 3. Reconstitutes clear in 30s 4. No sting. Mr. Leo passed all 4. HPLC attached. This is what legit looks like.