AHK-CU
$43.00 – $136.00Price range: $43.00 through $136.00
buy ahk-cu online, AHK-Cu (Copper Tripeptide-1) is a copper peptide used in research to improve scalp health and promote healthier hair. Studies have shown that when applied topically, it stimulates dermal papilla cells, which are crucial for the growth of hair follicles.
Buy ahk-cu online, Potential Benefits of AHK-Cu
AHK-Cu has several potential benefits for improving scalp and follicle health. By stimulating dermal papilla cells, it encourages the growth of hair follicles and supports regrowth of pattern hair loss.
Buy ahk-cu online, this peptide promotes skin repair, helping to rejuvenate damaged scalp areas. In addition, the copper ions of AHK-Cu supports the synthesis of collagen and elastin, key components for maintaining a clean, healthy scalp and improving elasticity.
One of the most important benefits of this peptide is its ability to reduce oxidative stress. By increasing the production of superoxide dismutase (SOD), AHK-Cu may help neutralize harmful free radicals that can damage follicles and lead to thinning. [4]
Buy ahk-cu online, his action not only protects hair follicle activity but may also help prevent the negative effects of DHT, contributing to a reduction in thinning and supporting overall scalp health.
It is also thought to promote better circulation, which supports the formation of new blood vessels in the scalp. This improved circulation helps nourish the follicles, encouraging the production of amino acids and other nutrients essential for follicle growth. By supporting tissue repair, AHK-Cu can also help reduce fine lines on the scalp, improving skin tone and skin elasticity.
Buy ahk-cu-online, How Should AHK-Cu Be Stored?
For best results, AHK-Cu should be stored in a cool, dry place, away from direct sunlight. Proper storage helps maintain the purity and stability of the peptide, ensuring its effectiveness for research into scalp health, follicle regeneration, and regrowth treatments.
| quantity |
10mg ,20mg ,30mg ,40mg ,50mg |
|---|
2 reviews for AHK-CU
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
DSIP 5mg
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
IGF1-LR3 1mg
Buy Peptide Injections | IGF-1 LR3 | 1mg
Specifications:
- Quantity: 1mg
- Form: Lyophilized Powder
- Sequence: MFPAMPLSSL…GGY (83 amino acids, with Arg³ substitution)
- Molecular Weight: ~9111 Da
- Purity: ≥99% (HPLC verified)
Klow 80mg (KPV/GHK-Cu/BPC157/TB500)
MOTS-C 10mg
Semax 5mg
Buy Peptide Injections | Semax | 5mg
Buy Peptide Injections, For In Vitro Research Use Only – Not for Human or Veterinary ApplicationProduct Overview:
Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH 4-10) developed for its neuroprotective and cognitive-enhancing properties. Buy Peptide injections, It is widely studied for its potential to modulate brain-derived neurotrophic factor (BDNF), improve neuroplasticity, and regulate stress response mechanisms.Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
- Molecular Weight: 831.0 g/mol
- Purity: ≥99% (HPLC validated)
- Storage:
- Lyophilized: Store at -20°C or below
- After reconstitution: Store at 2°C–8°C and use within 10–14 days under sterile conditions
Applications:
Semax is commonly used in research investigating:- BDNF expression and neurotrophic regulation
- Cognitive function and memory mechanisms
- Stroke, ischemia, and neuroprotection models
- Stress and anxiety pathway studies
Adipotide
buy adipotide online, Pepmanleo Pharmacy Online supplies this product solely for research use, provided in a freeze-dried (lyophilized) powder form. In accordance with regulatory guidelines, we are unable to offer guidance on dosage or instructions for reconstitution.
The amount listed on the product label reflects the total contents of the vial.
To reconstitute the product, researchers will need the following laboratory materials:
• A suitable reconstitution fluid
• Syringes for withdrawing the solution from the vials
• Alcohol swabs for sterilizing surfaces

Chris Perry –
Got it in 2 weeks. Love the service
Return customer. Highly recommend!
Amy David –
Shipped to Malaysia safe and sound😍.. fastest shipment ever.. took 10 days to arrived.. thank you pepmanleo