GHK-Cu
$38.00 – $85.00Price range: $38.00 through $85.00
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary Use
Product Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.
Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
| quantity |
100mg ,50mg |
|---|
8 reviews for GHK-Cu
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
AOD-9604
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
CJC 1295 no dac + Ipamorelin 5mg/5mg
GLP-3/Retatrutide
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol
MOTS-C 10mg
Semaglutide
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg 2ml sterile water = 20 x 0.1ml / 100mcg 1mg = 1000mcg
This product is not: - intended to treat, cure or prevent any disease - a sports supplement - approved for human application - an injectable medicineAdipotide
buy adipotide online, Pepmanleo Pharmacy Online supplies this product solely for research use, provided in a freeze-dried (lyophilized) powder form. In accordance with regulatory guidelines, we are unable to offer guidance on dosage or instructions for reconstitution.
The amount listed on the product label reflects the total contents of the vial.
To reconstitute the product, researchers will need the following laboratory materials:
• A suitable reconstitution fluid
• Syringes for withdrawing the solution from the vials
• Alcohol swabs for sterilizing surfaces

Desmond –
Great product quality,and even better customer service.
Robert trott –
Got my first order delivered,it took a bit because of customs but it was so worth it thank you Leo.
Oscar pinto –
Git my order in 5 days!thanks Leo I’ll be buying from you.
Amy David –
Shipped to Malaysia safe and sound😍.. fastest shipment ever.. took 5 days to arrived.. thank you Leo
Molly Browe –
Big vouch for Mr. Leo. Fast shipping, great comms, product is legit with COAs. 10/10 will order again.”
Molly Browe –
Big vouch for Mr. Leo. Fast shipping, great comms, product is legit with COAs. 10/10 will order again.”
Nathan Brown –
Fast shipping and packaging was solid. Vials arrived sealed, cold pack was still frozen, and no damage. Communication was clear the whole time. 5/5 x
Noah James –
Been ordering from them for 3 months now. Purity is legit and shipping was way faster than I expected. Customer service actually responds too. Highly recommend.”