Selank 5mg
$39.00 – $79.99Price range: $39.00 through $79.99
Buy Peptide Injections | Selank | 5mg | 10mg
Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro
- Molecular Weight: 751.9 g/mol
- Purity: ≥99% (HPLC verified)
Size and packaging guidelines
Fermentum scelerisque hendrerit parturient nullam enim lobortis litora parturient dictumst.
Potenti a quisque tincidunt venenatis adipiscing parturient fermentum nisl tincidunt amentu.
Scelerisque conubia lobortis a condimentum ad eleifend dui integer maecenas habitant nostra.
| Specification | Chair | Armchair | Sofas |
| Height | 37" | 42" | 42" |
| Width | 26.5" | 32.5" | 142" |
| Depth | 19.5" | 22.5" | 24.5" |
| Assembly Required | No | No | Yes |
| Packaging Type | Box | Box | Box |
| Package Weight | 55 lbs. | 64 lbs. | 180 lbs. |
| Packaging Dimensions | 27" x 26" x 39" | 45" x 35" x 24" | 46" x 142" x 25" |
Buy Peptide Injections | Selank 5mg
Buy peptide injections, Selank lyophilized peptide for in vitro research.
| quantity |
10mg ,20mg ,5mg |
|---|
1 review for Selank 5mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
AOD-9604
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
IGF1-LR3 1mg
Buy Peptide Injections | IGF-1 LR3 | 1mg
Specifications:
- Quantity: 1mg
- Form: Lyophilized Powder
- Sequence: MFPAMPLSSL…GGY (83 amino acids, with Arg³ substitution)
- Molecular Weight: ~9111 Da
- Purity: ≥99% (HPLC verified)
MT 2 10mg
Buy Peptide Injections | MT 2 | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂
- Molecular Weight: 1024.18 g/mol
- Purity: ≥99% (HPLC verified)
NAD+ 500mg
Buy Peptide Injections | NAD+ 500mg
Specifications:
- Quantity: 500mg
- Form: Lyophilized Powder
- Molecular Weight: 663.43 g/mol
- Purity: ≥99% (HPLC validated)
Semax 5mg
Buy Peptide Injections | Semax | 5mg
Buy Peptide Injections, For In Vitro Research Use Only – Not for Human or Veterinary ApplicationProduct Overview:
Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH 4-10) developed for its neuroprotective and cognitive-enhancing properties. Buy Peptide injections, It is widely studied for its potential to modulate brain-derived neurotrophic factor (BDNF), improve neuroplasticity, and regulate stress response mechanisms.Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
- Molecular Weight: 831.0 g/mol
- Purity: ≥99% (HPLC validated)
- Storage:
- Lyophilized: Store at -20°C or below
- After reconstitution: Store at 2°C–8°C and use within 10–14 days under sterile conditions
Applications:
Semax is commonly used in research investigating:- BDNF expression and neurotrophic regulation
- Cognitive function and memory mechanisms
- Stroke, ischemia, and neuroprotection models
- Stress and anxiety pathway studies
TB-500 5mg
Buy Peptide Injections | TB-500 | 5mg
Specifications:
- Unit Size: 5mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC)
- Molecular Weight: ~4963 Da
Tirzepatide / Niacinamide Injection
Buy tirzepatide/niacinamide injection online,dosage and administration of Tirzepatide / Niacinamide Injection requires careful individualization based on patient characteristics, treatment goals, and tolerance to therapy. The is available in multiple formulations to accommodate different patient needs and treatment protocols, with dosing typically following a gradual titration approach to optimize therapeutic benefits while minimizing adverse effects.
The available formulations include 17 mg/mL tirzepatide with 2 mg/mL niacinamide in 4 mL vials, 8 mg/mL tirzepatide with 2 mg/mL niacinamide in 2.5 mL vials, and 17 mg/mL tirzepatide with 2 mg/mL niacinamide in 2 mL vials. Physicians determine the most appropriate formulation based on the specific patients’ needs. Administration should occur via subcutaneous injection, with recommended injection sites including the abdomen, thigh, or upper arm. Patients should be instructed to rotate injection sites to minimize the risk of injection site reactions and to avoid injecting into areas that are tender, bruised, red, or hard. The injection should be administered once weekly on the same day each week, though the specific time of day can be flexible based on patient preference and lifestyle factors. Proper injection technique is crucial for optimal absorption and to minimize injection site reactions. Patients should use aseptic technique, including proper hand hygiene and skin preparation. The injection should be administered slowly and steadily, and the needle should remain in place for several seconds after injection to ensure complete delivery of the dose. Dose adjustments may be necessary based on patient response, tolerance, and individual treatment goals, as determined by the patient’s physician. Patients experiencing significant gastrointestinal side effects may benefit from temporary dose reduction or slowing the titration schedule. Conversely, patients who are tolerating the medication well but not achieving desired therapeutic outcomes may benefit from dose increases within the recommended range. Patients should receive comprehensive education about proper injection technique, dose timing, storage requirements, and what to do if doses are missed. They should also be instructed about signs and symptoms that warrant dose adjustment or medical evaluation, including severe gastrointestinal side effects, signs of hypoglycemia, or unusual symptoms that may indicate adverse reactions. Healthcare providers should work closely with patients to optimize dosing based on individual response patterns, treatment goals, and tolerance. Regular follow-up appointments should include assessment of therapeutic response, monitoring for adverse effects, and evaluation of the need for dose adjustments. This collaborative approach helps ensure that patients receive the maximum benefit from therapy while minimizing the risk of adverse effects.

Rebecca Simms –
Another order received. Great service as always 👏