-24%
Selank 5mg
Price range: $39.00 through $79.99
GLP-3/Retatrutide
Price range: $55.00 through $279.99
NAD+ 500mg
Original price was: $85.00.$65.00Current price is: $65.00.
Buy Peptide Injections | NAD+ 500mg
Specifications:
- Quantity: 500mg
- Form: Lyophilized Powder
- Molecular Weight: 663.43 g/mol
- Purity: ≥99% (HPLC validated)
36
Items sold in last 21 months
40
People watching this product now!
THE GOOD MOOD DESIGN
Carry on Stool
A dignissim dui varius hendrerit a mattis parturient consequat a suspendisse a phasellus hendrerit enim class dignissim et leo a potenti urna elit. In nam hac adipiscing condimentum parturient vestibulum.
THE OFFECCT STOOLS
This stools are also decently stored.
Ullamcorper vestibulum a ad sed blandit morbi curabitur ipsum bibendum adipiscing justo molestie eget nec laoreet accumsan adipiscing.
PROPERTIES
| Primis |
|
|---|---|
| Colour: | Ultricies senectus |
| Dimensions: | Hhimeos: 23 cm, Eleifend: 53 cm, Ullorper: 15 cm |
| Wolutpat: | 3.2 kg (vestibulum mus) |
| Mus nostra: | 34,2 cm |
| Netus dolor: | Yes |
| Facilisi: | No |
| Dignissim: | 216364 |
Gray
Sociis curae ad a a scelerisque augue ante seds hac cras montes sodales cras vestibulum vestibulum a a ullamcorper adipiscing id vestibulum.
Green
Sociis curae ad a a scelerisque augue ante seds hac cras montes sodales cras vestibulum vestibulum a a ullamcorper adipiscing id vestibulum.
Blue
Sociis curae ad a a scelerisque augue ante seds hac cras montes sodales cras vestibulum vestibulum a a ullamcorper adipiscing id vestibulum.
Orange
Sociis curae ad a a scelerisque augue ante seds hac cras montes sodales cras vestibulum vestibulum a a ullamcorper adipiscing id vestibulum.
THE GOOD MOOD DESIGN
The Designer Mattias Stenberg
A dignissim dui varius hendrerit a mattis parturient consequat a suspendisse a phasellus hendrerit enim class dignissim et leo a potenti urna elit. In nam hac adipiscing condimentum.
Description
Buy Peptide Injections | NAD+ 500mg
Buy peptide injections, High-purity NAD⁺ (β-Nicotinamide Adenine Dinucleotide) in lyophilized powder form.
Additional information
| quantity |
500mg |
|---|
Reviews (0)
Shipping & Delivery
Buy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
AOD-9604
AOD-9604 is a synthetic hexadecapeptide fragment corresponding to residues 176–191 of human growth hormone. It selectively stimulates adipocyte lipolysis by upregulating β₃-adrenergic receptors and inhibiting lipoprotein lipase, while sparing IGF-1 receptor activation. The peptide demonstrates oral bioavailability and reduces weight gain in rodent models without altering blood glucose levels..!
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
Semaglutide
Usage Instructions:
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg 2ml sterile water = 20 x 0.1ml / 100mcg 1mg = 1000mcg
This product is not: - intended to treat, cure or prevent any disease - a sports supplement - approved for human application - an injectable medicine
TB-500 5mg
Buy Peptide Injections | TB-500 | 5mg
Specifications:
- Unit Size: 5mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC)
- Molecular Weight: ~4963 Da
Tesamorelin 10mg
Buy Peptide Injections | Tesamorelin | 10mg
Specifications:
- Unit Size: 10mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC Verified)
- Molecular Formula: C221H366N72O67S1
- Molecular Weight: ~5135.9 Da
Reviews
Clear filtersThere are no reviews yet.