AHK-CU
buy ahk-cu online, AHK-Cu (Copper Tripeptide-1) is a copper peptide used in research to improve scalp health and promote healthier hair. Studies have shown that when applied topically, it stimulates dermal papilla cells, which are crucial for the growth of hair follicles.
Select options
This product has multiple variants. The options may be chosen on the product page
Bac Water 10mg
Buy Peptide Injections, Bacteriostatic Water
Specifications:
- Volume Options:
- 10ml Sterile Vial
- Ingredients: Sterile Water for Injection, 0.9% Benzyl Alcohol
- Preservative: Benzyl Alcohol (9mg/mL)
- pH: 4.5–7.0
- Shelf Life (Unopened): Up to 24 months under proper storage conditions
Select options
This product has multiple variants. The options may be chosen on the product page
BPC-157 5mg
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
- Molecular Weight: 1419.5 g/mol
Select options
This product has multiple variants. The options may be chosen on the product page
BPC-157/TB500 5mg/5mg Blend
Buy Peptide Injections | BPC-157/TB500 | 5mg/5mg Blend
Specifications:
- Quantity: 5mg/5mg
- Form: Lyophilized Powder
- Blend Type: Multi-peptide recovery support formula (inquire for exact composition)
- Purity: ≥99% (HPLC verified)
Select options
This product has multiple variants. The options may be chosen on the product page
Buy Semax Online, Semax/Selank 10/10mg Blend
Buy Semax online
- Quantity: 10/10mg
- Form: Lyophilized Powder
-
Semax
Sequence: H-Met-Glu-His-Phe-Pro-Gly-Pro-OH
Molecular Weight: ~889.0 g/mol
Purity: ≥99% (HPLC validated)
Select options
This product has multiple variants. The options may be chosen on the product page
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
Select options
This product has multiple variants. The options may be chosen on the product page
CJC 1295 no dac + Ipamorelin 5mg/5mg
Buy peptide online, CJC-1295 (No DAC) + Ipamorelin 5mg/5mg peptide blend for in vitro studies.
Select options
This product has multiple variants. The options may be chosen on the product page
DSIP 5mg
Select options
This product has multiple variants. The options may be chosen on the product page
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
Select options
This product has multiple variants. The options may be chosen on the product page
Glow 70mg (GHK-Cu/BPC157/TB500)
Buy Peptide Injections | Glow 70mg (GHK-Cu/BPC157/TB500)
Glow 70mg proprietary peptide blend for advanced in vitro research in skin rejuvenation, collagen support, and tissue regeneration.
Select options
This product has multiple variants. The options may be chosen on the product page
GLP-3/Retatrutide
Buy GLP-3/Retatrutide online, RT is a lyophilized peptide for in vitro use. Studied for its triple-agonist effect on GLP-1, GIP, and glucagon receptors in metabolic and weight regulation research.
Select options
This product has multiple variants. The options may be chosen on the product page
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol
Select options
This product has multiple variants. The options may be chosen on the product page