BPC-157 5mg
$34.99 – $69.99Price range: $34.99 through $69.99
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
Purity: ≥99% (HPLC)
- Molecular Weight: 1419.5 g/mol
Buy Peptide Online | BPC-157 5mg
Buy peptide online, BPC-157 lyophilized peptide
| quantity |
10mg ,30mg ,5mg |
|---|
5 reviews for BPC-157 5mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
AHK-CU
- Uhbuy ahk-cu online, AHK-Cu (Copper Tripeptide-1) is a copper peptide used in research to improve scalp health and promote healthier hair. Studies have shown that when applied topically, it stimulates dermal papilla cells, which are crucial for the growth of hair follicles..!
AOD-9604
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
GLP-3/Retatrutide
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol
NAD+ 500mg
Buy Peptide Injections | NAD+ 500mg
Specifications:
- Quantity: 500mg
- Form: Lyophilized Powder
- Molecular Weight: 663.43 g/mol
- Purity: ≥99% (HPLC validated)
Semaglutide
- Begin by ensuring that your hands are clean and dry.
- Take the vial of Semaglutide 2mg and inspect it for any signs of damage. Do not use if the seal is broken or compromised.
- Using a syringe, withdraw the recommended dosage of bacteriostatic water provided with the kit.
- Inject the bacteriostatic water into the Semaglutide vial, aiming to mix the contents thoroughly. Gently swirl the vial to dissolve the powder until a clear solution is achieved.
- Once mixed, ensure the solution is free from any particles or discoloration. Do not use if the solution appears cloudy or contains visible particles.
- Draw the reconstituted Semaglutide solution back into the syringe for administration.
Mixing Guide:
1ml sterile water = 10 x 0.1ml / 200mcg 2ml sterile water = 20 x 0.1ml / 100mcg 1mg = 1000mcg
This product is not: - intended to treat, cure or prevent any disease - a sports supplement - approved for human application - an injectable medicine

Wilson –
Just received my package from pepmanleo and I’m from Germany , no type of problems with the border patrol an arrived in at around 16 days which was a bit long . Going to start my Reta journey in about 2 days and report how I feel
Rebecca Simms –
Top Customer service,thanks Leo my package landed Canada safely.
James Turman –
Fastest peptide ship I’ve had in the States. Mr. Leo overnighted it. Vials proper, no underfill. 10/10″
Alyssaa Stuart –
First time ordering peptides, Pepmanleo walked me through reconstitution on text. Package came in 3 days, no issues. BPC-157 helping my knee already. Thanks for making it easy
Makasia Jones –
USPS delayed my pack 1 day. Mr. Leo responded immediately, sent new ice packs on next order free. That’s customer service. Product still perfect. This is why I only use domestic now.”