DSIP 5mg
$41.00 – $94.00Price range: $41.00 through $94.00
Buy Peptide Injections | DSIP | 5mg
Specifications:
Buy Peptide Injections | DSIP 5mg
Buy peptide injections, Research-grade DSIP (Delta Sleep-Inducing Peptide), 5mg lyophilized powder.
| quantity |
10mg ,20mg ,5mg |
|---|
2 reviews for DSIP 5mg
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
BPC-157 5mg
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
- Molecular Weight: 1419.5 g/mol
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
Klow 80mg (KPV/GHK-Cu/BPC157/TB500)
MOTS-C 10mg
Semax 5mg
Buy Peptide Injections | Semax | 5mg
Buy Peptide Injections, For In Vitro Research Use Only – Not for Human or Veterinary ApplicationProduct Overview:
Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH 4-10) developed for its neuroprotective and cognitive-enhancing properties. Buy Peptide injections, It is widely studied for its potential to modulate brain-derived neurotrophic factor (BDNF), improve neuroplasticity, and regulate stress response mechanisms.Specifications:
- Quantity: 5mg
- Form: Lyophilized Powder
- Sequence: Met-Glu-His-Phe-Pro-Gly-Pro
- Molecular Weight: 831.0 g/mol
- Purity: ≥99% (HPLC validated)
- Storage:
- Lyophilized: Store at -20°C or below
- After reconstitution: Store at 2°C–8°C and use within 10–14 days under sterile conditions
Applications:
Semax is commonly used in research investigating:- BDNF expression and neurotrophic regulation
- Cognitive function and memory mechanisms
- Stroke, ischemia, and neuroprotection models
- Stress and anxiety pathway studies
TB-500 5mg
Buy Peptide Injections | TB-500 | 5mg
Specifications:
- Unit Size: 5mg
- Form: Lyophilized powder
- Purity: ≥99% (HPLC)
- Molecular Weight: ~4963 Da
Adipotide
buy adipotide online, Pepmanleo Pharmacy Online supplies this product solely for research use, provided in a freeze-dried (lyophilized) powder form. In accordance with regulatory guidelines, we are unable to offer guidance on dosage or instructions for reconstitution.
The amount listed on the product label reflects the total contents of the vial.
To reconstitute the product, researchers will need the following laboratory materials:
• A suitable reconstitution fluid
• Syringes for withdrawing the solution from the vials
• Alcohol swabs for sterilizing surfaces

Madonna Allore –
Great product quality,Thanks pepmanleo I’ll order again once I’m out.
Mayra Herrera –
First oder arrived in 10 days to germany, well packaged and great customer support.