Klow 80mg (KPV/GHK-Cu/BPC157/TB500)
$68.00 – $107.00Price range: $68.00 through $107.00
Buy Peptide Injections | Klow 80mg (KPV/GHK-Cu/BPC157/TB500)
Buy peptide injections, Klow 80mg is a high-purity research compound for in vitro studies.
| quantity |
50mg ,60mg ,70mg ,80mg |
|---|
2 reviews for Klow 80mg (KPV/GHK-Cu/BPC157/TB500)
Clear filtersBuy Peptide Online, We understand the critical nature of your shipments. That's why we offer a full spectrum of shipping solutions tailored to the healthcare and life sciences sector. With our user-friendly software portal, proactive monitoring, and dedicated 24/7 support teams, we ensure your shipments reach their destinations safely and efficiently.
ALL YOUR SHIPMENT IN ONE PLACE
Pickup and Deliver Anywhere - Global and Domestic Shipping
From any pickup point to any destination, worldwide. Enjoy safe, reliable service with individual attention at every stage. For international shipments, our healthcare-specific customs brokerage knows the details to prevent customs delays.
Ship Anything - Boxes, Pallets, and Everything in Between
Whether it's lab samples, diagnostic test kits, or large medical devices - no matter what you need to ship, we have multiple options for each.
PROFESSIONAL SHIPPING EXPERTS, BUY PEPTIDE ONLINE
Related products
Bac Water 10mg
Buy Peptide Injections, Bacteriostatic Water
Specifications:
- Volume Options:
- 10ml Sterile Vial
- Ingredients: Sterile Water for Injection, 0.9% Benzyl Alcohol
- Preservative: Benzyl Alcohol (9mg/mL)
- pH: 4.5–7.0
- Shelf Life (Unopened): Up to 24 months under proper storage conditions
BPC-157 5mg
BPC-157 | 5mg
Specifications:
- Quantity: | 5mg
- Form: Lyophilized Powder
- Molecular Weight: 1419.5 g/mol
Buy Semax Online, Semax/Selank 10/10mg Blend
- Quantity: 10/10mg
- Form: Lyophilized Powder
-
Semax
Sequence: H-Met-Glu-His-Phe-Pro-Gly-Pro-OH
Molecular Weight: ~889.0 g/mol
Purity: ≥99% (HPLC validated)
Cagrilintide 10mg
Buy Peptide Injections | Cagrilintide | 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
GHK-Cu
GHK-Cu | 50mg | 100mg
Buy GHK-Cu online, For In Vitro Research Use Only – Not for Human or Veterinary UseProduct Overview
Buy GHK-Cu online, (Copper Tripeptide-1) is a naturally occurring copper-binding peptide composed of glycyl-L-histidyl-L-lysine. It is widely studied in in vitro settings for its remarkable regenerative, anti-inflammatory, and antioxidant properties. GHK-Cu plays a vital role in tissue remodeling, collagen synthesis, and cell signaling, making it a powerful molecule in regenerative biology and cosmetic science research. Onyx Research supplies this compound in a high-purity, research-grade lyophilized format, ideal for consistent, reproducible laboratory results.Specifications:
- Quantity: 50mg | 100mg
- Form: Lyophilized Powder
- Sequence: Gly-His-Lys-Cu
- Molecular Weight: ~340.8 Da
- Purity: ≥99% (HPLC verified)
GLP2-TZ 10mg
Buy Peptide Injections | GLP-2 TZ| 10mg
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Verified)
- Molecular Weight: ~4812.6 g/mol
MOTS-C 10mg
NAD+ 500mg
Buy Peptide Injections | NAD+ 500mg
Specifications:
- Quantity: 500mg
- Form: Lyophilized Powder
- Molecular Weight: 663.43 g/mol
- Purity: ≥99% (HPLC validated)

Mellissa B –
Arrived in Switzerland in 5 days. (8 days from ordering, including weekend). Thank you Leo and team 💜🫶🏼
Adam Shaw –
Delivery arrived about 14 days after order to the uk 👍